PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC15922_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MIKC_MADS
Protein Properties Length: 203aa    MW: 23597.4 Da    PI: 9.1601
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC15922_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF801.6e-25958150
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                 krien  nr vtfskRrng+ KKA+E+ vLCda+va+iif+s+gk+ +y+
  RrC15922_p1  9 KRIENANNRVVTFSKRRNGLVKKAKEITVLCDAKVALIIFASNGKMTDYC 58
                 79*********************************************997 PP

2K-box60.37.7e-2171164199
        K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                  yqk sgk+l+++k+e+l++e++++kke+++Lq e+Rhl+Ged++sL+lk+L+ +e+++e++l      K+e+l+++ ++ ++  +e+++   +L+++ 
  RrC15922_p1  71 YQKLSGKKLWDTKHENLNNEIDRIKKENDSLQLELRHLKGEDIQSLNLKNLMAVEHAIEHGLD-----KMEFLMTKRRNEKMLVEENRQLSFQLQQQE 163
                  899***********************************************************6.....89************************9987 PP

        K-box  99 e 99 
                  +
  RrC15922_p1 164 M 164
                  5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.375161IPR002100Transcription factor, MADS-box
SMARTSM004326.6E-38160IPR002100Transcription factor, MADS-box
CDDcd002657.83E-38280No hitNo description
SuperFamilySSF554556.8E-34296IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-26323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003197.4E-221057IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-263859IPR002100Transcription factor, MADS-box
PfamPF014869.1E-1282159IPR002487Transcription factor, K-box
PROSITE profilePS5129710.68984165IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MGRGKIEIKR IENANNRVVT FSKRRNGLVK KAKEITVLCD AKVALIIFAS NGKMTDYCCP  60
SMDLGAMLDQ YQKLSGKKLW DTKHENLNNE IDRIKKENDS LQLELRHLKG EDIQSLNLKN  120
LMAVEHAIEH GLDKMEFLMT KRRNEKMLVE ENRQLSFQLQ QQEMAIASNT RGMMMRDQDE  180
QFGYRVQPIQ PNLQEKIMSL VID
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D1e-15263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C1e-15263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B1e-15263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A1e-15263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_S1e-15163163Myocyte-specific enhancer factor 2B
1tqe_R1e-15163163Myocyte-specific enhancer factor 2B
1tqe_Q1e-15163163Myocyte-specific enhancer factor 2B
1tqe_P1e-15163163Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00080ChIP-seqTransfer from AT5G20240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9679610.0KC967961.1 Brassica oleracea var. viridis PI.a (PI.a) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001302977.11e-142floral homeotic protein PISTILLATA-like
SwissprotP480071e-139PIST_ARATH; Floral homeotic protein PISTILLATA
TrEMBLA0A078DHV71e-143A0A078DHV7_BRANA; BnaA03g08030D protein
STRINGBra020093.1-P1e-142(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53002751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.11e-141MIKC_MADS family protein